DPCstruct | MC32216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 121 ± 12 aa |
| Standard deviation of domain lengths | 12.33 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 66.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 45.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6K932 | 1-87 | MLTKVTDTSSARARSGKDIQGIPWERLNITRESYRCTRLEQYRNYEDIQLSGDVDKKCKQNSKIGNYYEFFHNTRSLKPKIIHFQAY |
| A0A446WJE0 | 1-133 | MSNYHDDHVEDMEDDYDMDDPAEDMVDAHHERGLRDSDSEDDEYAHSNDKIPDTSAADARKGKDIQGIPWERLAITRENYRQTRLEQ… |
| A0A426YJG3 | 1-119 | None |
| A0A453RI65 | 2-122 | None |
| A0A178WH02 | 1-104 | None |
| A0A178WFH5 | 29-140 | None |
| A0A804LL55 | 2-135 | None |
| A0A287HJ65 | 26-154 | None |
| A0A3N7GWX9 | 5-119 | None |
| A0A444X7W5 | 31-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.