DPCstruct | MC32215
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 94 ± 12 aa |
| Standard deviation of domain lengths | 11.82 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 54.28 |
| Pfam Score | 75.56 |
| Assigned Pfam label(s) | CL0092- PF04815- PF02580 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8LUV8 | 14-101 | QPEHQAFALLLEAPQVDAQIIIRDRFPVPRLVVCDQHGSQARFLLAKLNPSATYNNATDIAPGSDIIFTDDVSLQVFCEHLQRLAVQS |
| A0A446WJ38 | 28-112 | YVQMFAQLLQAPQEEADSIIKERFPVPRLVVCDQYGSQARFLLAKLNPSVTYDSDSPPPPGGDMIFTDDASFQVFMEHLQRLAVQ |
| A0A0F8AE77 | 1185-1271 | None |
| A0A2V0PPG6 | 379-475 | None |
| A0A7G2DNP8 | 1041-1128 | None |
| A0A811MZ27 | 339-429 | None |
| A0A2P2M8H3 | 1-69 | None |
| J3N7Y7 | 539-626 | None |
| A0A819YTF2 | 2-77 | None |
| A0A0C9YEK4 | 629-730 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.