DPCstruct | MC32212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 48 ± 0 aa |
| Standard deviation of domain lengths | 0.00 |
| Length coefficient of variation | 0.00 |
| Mean AlphaFold2 pLDDT confidence score | 90.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 79.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E5W6R6 | 50-97 | RTTHNELEKNRRAHLRSCLEKLKDMVPLGPEASRHTTLGLLTKAKRFI |
| A0A6A5EYE8 | 58-105 | RSTHNELEKNRRAHLRLCLERLKALIPLGPDCNRHTTLGLLNKAKAHI |
| A0A7J8E3T8 | 26-73 | None |
| A0A1W4X5T8 | 127-174 | None |
| A0A3P9AL24 | 166-213 | None |
| T1KE75 | 52-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.