DPCstruct | MC3221
Metacluster Properties and Pfam Annotations
| Number of structural domains | 126 |
|---|---|
| Mean domain length (aa) | 222 ± 51 aa |
| Standard deviation of domain lengths | 50.96 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 88.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.80 |
| Pfam Score | 85.72 |
| Assigned Pfam label(s) | PF00032- CL0328- PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H9U1R3 | 7-174 | IDLPAPSNISAWWNFGSLLLLCLMAQILTGLFLAMHYTSDISTAFSSVAHICRDVNYGWTIRNLHANGASFFFICIYLHIGRGLYYG… |
| A0A7X2TT01 | 7-205 | GITLFLFTMFTIQVLTGVLLLLYYRPSPAEAYESVQFIMTRVEYGWLVRSVHSWSANLVILAAFIHMFSVLFLDAYRKPRELTWLSG… |
| A0A5S9I7R4 | 2-143 | None |
| A0A1F6RCG0 | 31-261 | None |
| A0A4Q0P906 | 2-212 | None |
| A0A090MNH0 | 26-290 | None |
| A0A0R3UDB2 | 6-213 | None |
| A0A7X3WDF1 | 47-251 | None |
| A0A3A6Q1Q9 | 69-264 | None |
| A0A849WWJ1 | 18-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.