DPCstruct | MC32201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 249 ± 26 aa |
| Standard deviation of domain lengths | 26.19 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A828JHY6 | 14-229 | IYEEKEVTRNQWEARPAVDPYVVARHTGQLAQPGELRPYHLGDYRALQAAVDDMARKAGTTPPTLPALPEVLWVQHNGQGVTTPRQT… |
| A0A843PVT7 | 15-271 | VTLTLQARETFRLSGETRDRIRNIWAITPVSNGITVNNDQPHAGQHILEFPMKTFSQVMSQMQQHWPQIMQEVRSPKNPPNNLYIGE… |
| B7UEZ2 | 905-1159 | None |
| A0A2K4X3P4 | 341-594 | None |
| A0A6I6IIV0 | 482-735 | None |
| A0A2V3Q2N8 | 431-708 | None |
| A0A455VG88 | 595-871 | None |
| A0A2J5PSQ7 | 609-858 | None |
| A0A6M4P488 | 201-455 | None |
| A0A1B7HGB4 | 745-1002 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.