DPCstruct | MC3220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 141 ± 14 aa |
| Standard deviation of domain lengths | 14.13 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838QQ23 | 1-115 | MSKPDYDDAEVEERWCSEQQRIVADYLRSQGVEHGRIGEWPAWHIAPYASIWAIESHAQPEWIGWWVICGDLPTDYISSVDVKPPQH… |
| A0A7Y0P147 | 2-139 | SDEDEDRWCAEQRANVIAYLAGEKCASTSVGEWPAWYMPPLLSVWAVESAERPGSVGWWAISGDFPTDYTECRGERHPRQGLRDIGR… |
| A0A7C5BSG8 | 183-334 | None |
| A0A7C3LIS9 | 244-393 | None |
| A0A7Y5UT38 | 15-151 | None |
| A0A316FKS3 | 15-183 | None |
| A0A7Y2Z089 | 11-155 | None |
| A0A5J6MIW5 | 2-146 | None |
| A0A2N6CPV8 | 46-198 | None |
| A0A4Y6IDP7 | 4-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.