DPCstruct | MC322
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5583 |
|---|---|
| Mean domain length (aa) | 128 ± 30 aa |
| Standard deviation of domain lengths | 30.20 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 72.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.27 |
| Pfam Score | 98.35 |
| Assigned Pfam label(s) | PF00057- CL0550- CL0263- PF16833- PF05794 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R4IBV3 | 85-213 | MRIHTGEKPFTCTQCGKSFSQSSNLNIHMRIHIRKKPFKCTQCGKSFNRSSDLHQHIRIHTGEKPFTCTQCEKSFNCSSNLYTHMRI… |
| A0A668U6U1 | 10-120 | RHTQIHTGEKPYSCKTCGKNFRRNYHLTIHMRTHTGEKPYHCQTCSKKFCRHLCNTCGKSFHHKSILMEHKIIHSDEKQYSCKTCGK… |
| A0A1A9XKV8 | 502-634 | None |
| A0A834Y839 | 151-287 | None |
| A0A834Y3Y1 | 244-363 | None |
| A0A834XZV0 | 278-405 | None |
| A0A1A9XS80 | 284-385 | None |
| A0A3N4IGQ2 | 194-317 | None |
| A0A1V6SE35 | 1-140 | None |
| A0A1A9XC26 | 827-1019 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.