DPCstruct | MC32196
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 316 ± 81 aa |
| Standard deviation of domain lengths | 81.32 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 88.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.46 |
| Pfam Score | 87.81 |
| Assigned Pfam label(s) | PF17042- PF07005 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I4PRJ0 | 2-168 | LVKAGMRTIQTIGVPQRPIAPDVDAVVIALKSRTNPAEEAVSMSLGALEWLRSQGVRQVYFKYCSTFDSTPAGNIGPVADALLDAVG… |
| A0A090TDI6 | 2-335 | INKLGVIADDFTGATDAASFAAKSGLRVVQLSGIPSQDERIDADVLVVSLKSRSCPADIAIQQSLNASNWLLSQGCTQIYFKYCSTF… |
| A0A2U8G9C0 | 6-431 | None |
| A0A521VKV2 | 50-305 | None |
| H0EY20 | 496-897 | None |
| A0A412IZH1 | 2-288 | None |
| A0A515EV09 | 69-389 | None |
| S3ZES3 | 2-362 | None |
| A0A7X2PI79 | 2-346 | None |
| A0A365CZP3 | 4-393 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.