DPCstruct | MC32195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 142 ± 35 aa |
| Standard deviation of domain lengths | 34.56 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 86.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 38.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4P3A3 | 9-124 | FHLFSLPASHIPLPEKFTYPFHYTPHPLCVLAAEEVKRYIGSRKEWEAELSLGKMFGVLAVQDEQGTVGYLAAFSGNLAGRNDHPYF… |
| A0A090WHX8 | 1-101 | MPSLENCFTPFKTDISGISIPEKFTFPIFYEPHELSLIATRELQEYLEQPQNWQHNFWNEKTGAGEAAGKMFGVLVVQNEKGELGYL… |
| A0A3A5FTG0 | 60-237 | None |
| A0A1Y4AKW8 | 12-127 | None |
| A0A6F9Z8Y0 | 1-121 | None |
| G7F1H0 | 1-107 | None |
| A0A3C0CFP3 | 2-200 | None |
| H1HMW0 | 2-191 | None |
| A0A090WXJ5 | 9-135 | None |
| A0A090TBM5 | 8-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.