DPCstruct | MC32192
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 85 ± 14 aa |
| Standard deviation of domain lengths | 14.49 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 57.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090SUQ7 | 6-109 | SLPDFETVRKQGIVKRSDPNGHYVAYQAFREDPENNPLTTPSGKVEIYSEELARLAAEWELPEGDVIHPLPIYVSTSEAGIRQCAIN… |
| A0A090R6H8 | 416-492 | LKLDASLPDFETVRQQGIVKRSDPNGHFVAYQAFRENPEANPLNTPSGKVEIYSEALANIAAEWELLEGDVIHPLPI |
| A0A447JED2 | 77-188 | None |
| A0A3M3UC19 | 298-377 | None |
| G5Q2Z9 | 101-177 | None |
| A0A0B8P6A2 | 157-233 | None |
| A0A485JHD4 | 9-86 | None |
| A0A377D3Z5 | 201-278 | None |
| A0A2X3EQQ3 | 1-110 | None |
| A0A447JHS8 | 206-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.