DPCstruct | MC32191
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 80 ± 12 aa |
| Standard deviation of domain lengths | 12.17 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07603 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090SUR8 | 23-107 | TFCFTGQASSSESLSYKIVDTGQSVCSDASTQLSTCPVQGEYGFGQDAQYQGYAPSYTANNDGTVSDNVTGLMWAASIDTNGDGK |
| A0A0E3KTD9 | 9-73 | TTTVVKYTLVDTGQTACYDDEGNEMECPESGETFYGQNAQFTGNLFSYTDNGDRTVTDEVTGLMW |
| A0A2N7CUG4 | 12-95 | None |
| A0A1V1P9M7 | 1-97 | None |
| A0A3M1H2R7 | 30-128 | None |
| A0A2H6HS68 | 21-99 | None |
| A0A1S9CAD0 | 2-85 | None |
| A0A357HWM6 | 16-94 | None |
| A0A256WGK3 | 40-122 | None |
| A0A357I016 | 8-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.