DPCstruct | MC3219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 121 ± 20 aa |
| Standard deviation of domain lengths | 20.32 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 31.15 |
| Pfam Score | 79.29 |
| Assigned Pfam label(s) | PF06289- PF06429- PF07559 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D7GF23 | 224-347 | FVSTVNQDGFTSGRLDGLEVDANGTVRANYTNGQNNPLGKLVLANFNNQNGLKQIGNATYVETAVSGTATVGEAGAEGFGTVLSGSL… |
| A0A7C2AFD1 | 268-382 | TGQLSGIDISDTGIVLSRFTNGQTRILGQVQLANFTNPQGLRQLGDTTWAESFESGQGVISQPGSSGLGLIQSGALEGSNVDLTEQL… |
| A0A352P198 | 160-282 | None |
| A0A7Y7CTM1 | 302-434 | None |
| A0A3C1PW46 | 724-850 | None |
| A0A1A9UKL0 | 910-998 | None |
| A0A1H4LLG9 | 414-547 | None |
| A0A7C3M1C6 | 183-296 | None |
| A0A6I1KIR1 | 141-262 | None |
| A0A840UKY2 | 101-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.