DPCstruct | MC32186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 110 ± 19 aa |
| Standard deviation of domain lengths | 18.73 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.09 |
| Pfam Score | 98.81 |
| Assigned Pfam label(s) | CL0061- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N4URR4 | 5-123 | QHSAFGAAEYIPPDPIFEVTKRFNADQNPQKVNLGQGTYRDENAKPWVLPSVREAEKLIGNAGHEYLPIEGLQSFRDEATKLLFHDT… |
| A0A090SQ59 | 2-95 | FEKVVAAPADPILGLTEEFKKDTRAEKINLGVGIYKNEQGETPVLATVKKAEAALLETEKTKSYLTIEGTAEYGLAVQKLLFGVDAE… |
| A0A034W281 | 2-79 | None |
| A0A6A4PQF2 | 28-156 | None |
| A0A5C6SPP5 | 1-131 | None |
| A0A3Q0IZJ4 | 24-159 | None |
| A0A553NLV0 | 1-120 | None |
| A0A6J1WG41 | 3-75 | None |
| A0A220VEJ9 | 2-112 | None |
| L8YDZ8 | 34-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.