DPCstruct | MC32184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 125 ± 15 aa |
| Standard deviation of domain lengths | 15.26 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 94.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090SNQ1 | 9-159 | AVNRGHDSLHEDVIGLRLLCLYGLKGAAAYLEHARVLSQTDEAVYGEYHQIMAWLGTDPVDLEPLLNTSMQIGLMNYKIMEMLDKGE… |
| A0A645B3T1 | 6-122 | EHAYNLGHEDLSIYAFMQSALVKTTDDSLTADELTALVMETGSNGVKVMALLDKANTTAYGNPEITKVNIGVRNNPGILISGHDLKD… |
| A0A2X3EQS6 | 2-101 | None |
| A0A447MV43 | 2-121 | None |
| A0A0V0QJA2 | 299-429 | None |
| A0A1V1V523 | 50-171 | None |
| A0A2J8ABA3 | 155-275 | None |
| A0A848A5Q6 | 153-271 | None |
| T0CXD4 | 57-177 | None |
| A0A6M1HXB7 | 28-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.