DPCstruct | MC3218
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 136 ± 9 aa |
| Standard deviation of domain lengths | 8.64 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7D991 | 349-482 | NSFEVGERLAKSLLQLFDPSTKAPERPVKDEHHLLPTFKMPRIKHGHLPGDYRYLKVWAPGQRKDLRERMSQANFGRALVTGVPETG… |
| A0A2A5ATF8 | 1-144 | MDRYNGREMGSRLARSVFDIYDPSIQTGSGQSPHEQSSLQDEELPTFFLPQGLGTTIPGNIIYYHINTTNKLIPKLDYEENKNRKDL… |
| A0A7S0RD08 | 252-379 | None |
| A0A5K3FBQ4 | 651-784 | None |
| A0A0A9XVQ1 | 3-136 | None |
| A0A834KCA0 | 53-193 | None |
| A0A0W8DMU5 | 881-1037 | None |
| A0A6I9NRN1 | 162-292 | None |
| A0EGL6 | 859-990 | None |
| A0A7R9K7D6 | 2-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.