DPCstruct | MC32176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 95 ± 10 aa |
| Standard deviation of domain lengths | 9.79 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5V4A0 | 90-167 | RVLIVIAVFYGSIKQATLAWQLGDIGVGLMAWINLVAIFLLFPKTIRSLKDYEQQKKKGLDPVFDPEKLNIKKADFWE |
| A0A090SAB0 | 1-113 | MFLLKLVLITSVFYGTVKAANLAWAMGDVGVGLMAWLNIVGILIIFFIAKPAIVALKDYEKQQKEGVEEYTFNPVALGIKNADYWEG… |
| A0A199P6Q4 | 2-99 | None |
| A0A2G6EQV5 | 10-106 | None |
| A0A5N5V541 | 75-166 | None |
| A0A2C5HX79 | 11-99 | None |
| A0A524JQE9 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.