DPCstruct | MC32174
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 187 ± 33 aa |
| Standard deviation of domain lengths | 33.26 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.17 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | CL0014- PF07589 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A084GIX9 | 626-835 | MQQQEGGPGYLERGLGFFQYGIIDQHFDNKARLGRLIATAYEKGDRNQLSYGIDEDTAMVVRNAEKKIEVVGRAGVTVVDLSEVQTN… |
| A0A2C1K4U2 | 3-139 | GRGGVSLVDLSSMKKTGRKMENIELSWLTEGDQYSLDTHQFKIKESKVETKGYEYYNSPVAPHSGVLTPHGSLGHFLSYQLVDNGAV… |
| A0A510XZT3 | 290-512 | None |
| A0A7R7GB26 | 343-569 | None |
| A0A6N8FCV7 | 7-159 | None |
| A0A845GG11 | 65-278 | None |
| A0A6M0GF39 | 57-209 | None |
| A0A164WU25 | 95-257 | None |
| A0A4R6QFE8 | 646-846 | None |
| A0A6M8BEK1 | 6-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.