DPCstruct | MC32171
Metacluster Properties and Pfam Annotations
| Number of structural domains | 195 |
|---|---|
| Mean domain length (aa) | 96 ± 19 aa |
| Standard deviation of domain lengths | 18.73 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 27.19 |
| Pfam Score | 93.36 |
| Assigned Pfam label(s) | CL0123- CL0426 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150TGK3 | 163-257 | APAAPVAASPAQADPGVELEEGDVPLFEALRAHRAALAKEKSLPAYIIAHDRTLREIARIRPASLDDLALARGMGQAKISSYGEGIL… |
| A0A7K0XGW0 | 1-58 | WRAARAKEREVPAYIVFTDVTLMAIVERQPSTMDELEEIPGIGRSKLEAYGEALLGIL |
| A0A2V9X2U4 | 264-357 | None |
| A0A177LE55 | 27-141 | None |
| A0A1E3BUU1 | 62-157 | None |
| A0A444XGH9 | 4-79 | None |
| A0A7X9B9V2 | 225-318 | None |
| A0A6J7ILU2 | 132-208 | None |
| A0A2V7S1W5 | 24-123 | None |
| A0A5N6PQL2 | 51-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.