DPCstruct | MC32164
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 303 ± 58 aa |
| Standard deviation of domain lengths | 58.24 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04738 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G1C270 | 1-330 | MTQYKIFDKYVLRAPICSLSFYKKLTENSEVTEEQLKLICSDKKIKEALFLASPSFYFELEKWLKNKVKKQNDIERIKLSLLKYLSR… |
| A0A4U9TDU0 | 35-321 | SSFFKNKIIEETIMTTTYHLYKSLTKISYDSETKKARNAKESFLKYLIRMSTRGTPYGLLSGISLGQFDEKPNIQIQEDINYYYKSV… |
| A0A2N0FPK6 | 145-425 | None |
| A0A318NQU5 | 406-724 | None |
| A0A376EMC9 | 6-305 | None |
| A0A6C1C4E7 | 290-704 | None |
| A0A4Q1ESG9 | 31-376 | None |
| A0A1S8L407 | 8-251 | None |
| A0A076MIH9 | 3-239 | None |
| A0A2P9HY86 | 15-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.