DPCstruct | MC32160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 93 ± 12 aa |
| Standard deviation of domain lengths | 12.43 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 21.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04472 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P5R129 | 59-160 | RVRDDSGVTVRGPVGQPQKNVKPLDAATVEPVTLKPTSYGHCKEIAERFKSGQPVIMNMIATHPEEGRRIIDFVSGLAFGLNGSLER… |
| A0A6I7NFM6 | 11-83 | RTAFIKMSEDIDVFDLADKLMLRQPLIVNFETYDLVESNRVIVFLSGVIYALDGEVEVLRERIFAFATKPDMK |
| A0A388TAZ1 | 2-106 | None |
| A0A7X0M5J7 | 6-98 | None |
| A0A7J0CK76 | 13-91 | None |
| A0A4R3YSI9 | 2-76 | None |
| A0A4V2W5Z4 | 16-94 | None |
| A0A7X9KZ14 | 157-252 | None |
| A0A135YTQ4 | 50-166 | None |
| A0A537ZIY9 | 109-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.