DPCstruct | MC3216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 99 ± 9 aa |
| Standard deviation of domain lengths | 8.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C0WKQ1 | 10-105 | VHVLIKMADGQGWTPHSYQPKIQMLSFVKADEKGKTMRINIYLSKMTVATCLEHPGKGKTQMFRRLVSDPLLKRIFANPRCHSGRGY… |
| A0A1Z5K9B9 | 14-106 | GYIVSKDRFTISQVREIAYAFRYTEIMLNDVSRVISFRRDRARINVYYSTGTVGTCLSHPTKGKTQLFRRDVTLQELKQLFQDPRLH… |
| K0TGK6 | 61-173 | None |
| A0A7S4EV82 | 9-115 | None |
| A0A1Y2BGI0 | 4-95 | None |
| A0A7S1YZS4 | 81-176 | None |
| A0A0D2N4I8 | 1-110 | None |
| A0A7S2UAU7 | 28-138 | None |
| A0A7S2UB42 | 12-103 | None |
| A0A7S2UNG1 | 23-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.