DPCstruct | MC32152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 140 ± 13 aa |
| Standard deviation of domain lengths | 13.10 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R0VXW7 | 1-146 | KVVAADPNTVSGIKSVGTLIDELWLFGKQYKAEDMLREAIGGLASRPEGFVVYTTTQSNEPPAGVFRQKLQYARDVRDGKIHDPHFL… |
| A0A839PCU8 | 76-219 | TITHRNSGASLQIKAADTDVITGSKATYTLIDETHVFAKKPRAADVFVEVRGALAARPDGFLIQVTTQSKDTPSGVFKQELETARKV… |
| W2E7P3 | 1-149 | None |
| A0A7Y5IDM9 | 257-403 | None |
| A0A854VXG8 | 1-105 | None |
| A0A766CTU3 | 38-176 | None |
| A0A827N0U3 | 96-228 | None |
| A0A7H4PJW7 | 21-168 | None |
| A0A1S1UBG8 | 160-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.