DPCstruct | MC3215
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 96 ± 10 aa |
| Standard deviation of domain lengths | 9.78 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12345 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J4H707 | 53-143 | EFLLRSGNYASYMEKLVTAFNPAAAAGVMCRNTISVGWDGMLYDCDFNQMLELPVQAASRHIAHYNARELKDRDIVVRQHCYGCTAG… |
| A0A7C0VX63 | 21-111 | LSDTEYNEYMKLLEDNFNPDTIGRLPCRGVVSLGPDGRFFDCDFYAGADLPVKCESASVDNFNYDILNNREIATTPSCFLCTADQGA… |
| A0A7V8BE88 | 6-94 | None |
| A0A7R9ZS79 | 88-182 | None |
| A0A7J7IJF8 | 167-266 | None |
| A0A7S3SSZ5 | 27-132 | None |
| A0A2N3F4W8 | 213-306 | None |
| A0A518BP48 | 10-105 | None |
| A0A7C1QRF5 | 127-218 | None |
| A0A8B6CX41 | 2-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.