DPCstruct | MC32148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 248 ± 20 aa |
| Standard deviation of domain lengths | 19.72 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.88 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | PF19635- CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A809QZP0 | 1-264 | MQRWRHAGDRKNFGDWLVLTIDIQMDEAGLQAACEQLIAATSDMEKFLDLGNGKQSSDYKIIFRHGDTIVHERAFFHEGVKFAALRS… |
| A0A1G4R1S9 | 3-231 | TIEIGILSEEEAAYREALDFICGLLQQGFPKGYELKLESKEKRYLPLKKLAKSGLHQFFANALRYPTLFPQLAAYAELAMEEFAWYQ… |
| A0A0U3BI96 | 33-281 | None |
| F9RF61 | 111-360 | None |
| A0A1C3UCY2 | 203-451 | None |
| A0A7L5XZP6 | 15-232 | None |
| A0A1G7BVT3 | 438-719 | None |
| J5VPQ6 | 82-303 | None |
| A0A0R3LL02 | 256-510 | None |
| A0A1I4AE50 | 139-376 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.