DPCstruct | MC32145
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 456 ± 70 aa |
| Standard deviation of domain lengths | 70.06 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 19.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10593 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S0YNB4 | 35-528 | AIHQDAAQMLRELWRERGYNLGRPIPEMKALFETDLLPVMREERYNPGYPYPKRYEELLPYINEAFAEMMVGVTDSSGPVMQVDTEG… |
| A0A0F6W837 | 270-782 | PALILDDEADQATLDANLARNVRKQTKGEVPGDPTAIYTAVVDGLRKTLRHHVFLQVTATPYALLLQSVGTELRPSFTRLLEPGDGY… |
| A0A379ZH63 | 38-457 | None |
| A0A5M9GZE6 | 469-951 | None |
| A0A449G7M3 | 11-369 | None |
| A0A255TS63 | 320-786 | None |
| A0A5N9VUJ0 | 4-348 | None |
| A0A4R2ZHF3 | 445-880 | None |
| A0A1X3A6B1 | 80-531 | None |
| A0A3C1INL1 | 178-762 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.