DPCstruct | MC32142
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 96 ± 17 aa |
| Standard deviation of domain lengths | 16.69 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 91.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7PIE7 | 11-89 | QPRVARDFFIRYQDRILFGKDSFQPDEYPYYWRVFETADDYFDYYRPYHAFWKLYGIDLPDEVLRKLYYGNAQRITPGL |
| A0A7C6E0K5 | 199-302 | ISADIETAERFLDTYRNVNLDLTPGIEMYSNFSKRLEEWREFFIRHQDRILFGTDIFGGEKVETALAKVMLVRSFLELEEGLNLPRP… |
| A0A838QUJ5 | 59-156 | None |
| A0A7V2EVD7 | 105-206 | None |
| A0A7Y2VCY0 | 167-258 | None |
| A0A7C5MJH7 | 11-88 | None |
| A0A2M8B4D1 | 265-383 | None |
| A0A355J010 | 9-106 | None |
| A0A6A7L3F5 | 117-196 | None |
| A0A7Y8LWK0 | 23-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.