DPCstruct | MC32133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 88 ± 11 aa |
| Standard deviation of domain lengths | 11.40 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.91 |
| Pfam Score | 98.15 |
| Assigned Pfam label(s) | CL0061- PF03711 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I8CHL0 | 317-412 | SPKEAYEALVANRVDYVPLDQVRNRVSATLALIYPPGIGVVLPGERWDDRAQPMLDYFMAFQESFNRFPGFNYEVQGVFQEREDGRI… |
| A0A7K1EWT1 | 12-102 | ATSLSWSVIPTVAISMRDAYFAETEMVSAERAVGRISADLIAPYPPGVAVVAPGEVLTQLIVQGLATTKAAGVRIAYATDPTLASYR… |
| B0E8W5 | 766-848 | None |
| A0A1I8FRD5 | 550-647 | None |
| A9TN98 | 505-589 | None |
| A0A0A0LSC9 | 2-69 | None |
| A0A7V6XKP9 | 38-129 | None |
| A0A7C3D4J2 | 7-85 | None |
| A0A645JGS4 | 2-62 | None |
| A0A2N9IF35 | 449-533 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.