DPCstruct | MC32131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 141 ± 20 aa |
| Standard deviation of domain lengths | 20.41 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0629 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A197SS73 | 3-116 | ERADFLMARTYREFPAYARQREEPFDWDTDGCSPPTPRSWARAFQDACVIHDFGYRNYGGQRLRLDPTEARRKSIDDRLLEEMLRIC… |
| A0A7K1EKI4 | 10-139 | AAIFSATAPPPPPHAVAHTMMFRTALASFIATAQSSTRDQRLDWTTDGCSAPIVGSTGRTFDFTHACQRHDFGYRNFKALHGGKWWT… |
| A0A178ANB5 | 8-147 | None |
| A0A084AQI0 | 22-148 | None |
| L7JAT8 | 3-132 | None |
| A0A6A6Z6U0 | 270-372 | None |
| A0A179HKQ7 | 12-175 | None |
| M1VZP1 | 15-171 | None |
| C4JJ58 | 11-168 | None |
| G8S253 | 11-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.