DPCstruct | MC3213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 136 ± 20 aa |
| Standard deviation of domain lengths | 19.89 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 16.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7AV24 | 10-146 | FDAYLKLKLKDLNKLVAKEAVELMTNFYKEVKSIECAKESSDMLLFQYNANFEDKNKYDLNITRQFIPIPDQSEILQLSLTLTYSSN… |
| A0A6G7ZWC6 | 12-132 | VSGLTAWEAFKAFGREAFELPGVGLLFQTGTFDFTGSELFYFDPVCQFEILDHDGEHDHFEQLHCELTCEPRPELQTASAELWSFDF… |
| A0A517QNE3 | 358-519 | None |
| A0A255ZMM2 | 2-102 | None |
| A0A849GU01 | 76-221 | None |
| A0A1G4S9N1 | 207-337 | None |
| A0A6B4LNL4 | 11-129 | None |
| A0A5B9WDP6 | 1-139 | None |
| A0A810NST5 | 14-179 | None |
| A0A0N8HCT8 | 4-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.