DPCstruct | MC32129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 58 ± 3 aa |
| Standard deviation of domain lengths | 3.09 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 68.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821BU85 | 1-62 | HKLDVLTCGRQTGLVQKAICSGFFRNAAKRDPQEGYRTLVDSQVVYIHPSSSIYHRQPEWYV |
| A0A315B5A8 | 5-56 | KLDVVSAGKNFTKIRKTITAGFFFHGARKDPQEGYRTLVKKQPVYIHPSSAL |
| A0A6D2LBN2 | 318-374 | None |
| T1IJK0 | 867-926 | None |
| A0A444YWG3 | 291-348 | None |
| A0A2G9UH76 | 44-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.