DPCstruct | MC32127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 86 ± 14 aa |
| Standard deviation of domain lengths | 13.51 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0248 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3L0V9 | 227-320 | YDQLGAGPHNPIDLPENVRGMADDPYRSVAGEVRERGGYRKNDAPFSEFLWAQFFRAHLTVHPVYHGFEAALAQAMALAKTTAANGL… |
| A0A0P0RIG9 | 1-80 | MFRQVWELIDDEYRSLSATVRDAGGYKKTNVPLAEFRWADFFRQMLGSPNSNAEYKALVDEAVKLAQSDTAIGLPGYVGV |
| A0A840A3M8 | 69-154 | None |
| A0A6I1L2Y7 | 1-78 | None |
| A0A4R0WQ88 | 40-124 | None |
| U3UAV8 | 23-103 | None |
| A0A329AZ36 | 164-237 | None |
| A0A258VJR0 | 154-223 | None |
| A0A0D2KG21 | 64-189 | None |
| Q3JSU4 | 366-443 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.