DPCstruct | MC32122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 94 ± 12 aa |
| Standard deviation of domain lengths | 11.52 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.91 |
| Pfam Score | 95.86 |
| Assigned Pfam label(s) | CL0023- CL0178 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653CTZ5 | 2-88 | ARGVHERSGLPFFEVFVDTPLAVCEQRDVKGLYQKARQGLIKSFTGIDQEYEKPEHPELVLKAAQSSIEESVEQVLGILKEHGILSN |
| A0A850MWI8 | 1-74 | FVLTYVKCPLDVCIKRDNKGLYKKAIAGEIKNFTGISHPFEEPINPEIIIETDKESSKECKKKIIKKLEDLGYL |
| A0A7W0TJP3 | 24-115 | None |
| A0A2T4CH61 | 253-346 | None |
| A0A7Y2XYS4 | 212-307 | None |
| A0A164IPI9 | 1-60 | None |
| A0A0S7E7Z2 | 743-841 | None |
| A0A7Y6V672 | 8-91 | None |
| A0A6A3APN7 | 83-176 | None |
| A0A7G6XAM5 | 214-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.