DPCstruct | MC3212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 181 ± 19 aa |
| Standard deviation of domain lengths | 19.14 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7ALP5 | 287-474 | PALEYHKALGNWVLERIGGKNISASPRIALPAGCFDVAIEHHNGIVVLCENGHFGTACALIRVIFEACVRGIWLHNCATEDELIQYR… |
| A0A3C0NWW0 | 12-207 | ELSSACDLSAWISTKLNELTISDVNTRKRVVAPCFAIALDHFDAMLVLFGRSPKICSSAFALTRLVFESYIRGMWLMHCATDEQVEN… |
| A0A328LYN2 | 5-193 | None |
| Q1Z9L3 | 2-156 | None |
| D7DII1 | 7-195 | None |
| A0A6N9D001 | 3-177 | None |
| A0A370DMU4 | 2-163 | None |
| A0A656QJJ3 | 19-216 | None |
| A0A0U4CUB4 | 6-165 | None |
| A0A4Y5Z4L6 | 14-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.