DPCstruct | MC32119
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 156 ± 23 aa |
| Standard deviation of domain lengths | 23.14 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.31 |
| Pfam Score | 73.19 |
| Assigned Pfam label(s) | CL0678- CL0124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653CPQ0 | 8-188 | LCVILWIVDINAIILEQGDLCMTSEKIQGKCVLITSCRSVMESVKKLGKFPTMEDTCGFKGLQTVICCPDDFNVSSKIQVQPENKTV… |
| B0WPG6 | 11-138 | VLNETCTTTSLQVGRCVLPINCEYALKILRSTYISDEEWYYLHNNKCGTIREGRIPKPLICCPVVSNVPSCGVSVNNRIFGGEETAF… |
| A0A2W1B4R3 | 26-208 | None |
| A0A7R8XJA4 | 53-263 | None |
| A0A6P4EJ77 | 50-180 | None |
| A0A7R9LEL9 | 148-326 | None |
| A0A1Y1NGW4 | 21-166 | None |
| A0A182FSI6 | 12-158 | None |
| A0A139WGX8 | 9-164 | None |
| A0A1D2N4Q6 | 10-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.