DPCstruct | MC32118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 136 ± 20 aa |
| Standard deviation of domain lengths | 19.94 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 41.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E1W4P2 | 1-134 | MRQSSTLILLAVMVAQAYCAPQLISFKDGKIGVNFAGYHAAAGLGGLLGNGATGGLFAEAGTPHGQSARAGLGGAVDANGGSSGGLY… |
| A0A653CN39 | 4-155 | FAYVMVLTYLFGLVYGRPTEGEVEAGGEAKVSIPKLISFENGGIGINFLGFRARAGLGGLLTGNAADGGLFAEAGTPFGQNARAGLG… |
| A0A6I9WHT5 | 1-192 | None |
| A0A6H5I9X5 | 337-463 | None |
| A0A834KCJ8 | 11-139 | None |
| A0A6J0C6Z1 | 29-163 | None |
| A0A1A9VST3 | 62-177 | None |
| A0A811VF65 | 5-114 | None |
| A0A0N1I3N7 | 9-141 | None |
| A0A336MFZ2 | 2-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.