DPCstruct | MC32117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 237 ± 18 aa |
| Standard deviation of domain lengths | 18.37 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15383 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6P0R2 | 121-359 | LTARSNQSKTTESKKKKTPRRRNTTFQENAITGGFTRADKMRKKKESAEKVEEEITEGTAFQRFTDRASAVSAVIYHYSQGMLGGLC… |
| A0A653CLT3 | 20-267 | GDDHRISNKIYVQKKNRFEPVPRPGYGENYIDTDQDDTEKGDCLDAFYPITISALYQKCWSKLGLVCHGLLGGLALSHALYVGVCFQ… |
| A0A4U8UU30 | 1-215 | None |
| A0A553N034 | 64-326 | None |
| U4UUU7 | 1-247 | None |
| A0A7R9FSR0 | 615-848 | None |
| A0A3B5AAB8 | 2-196 | None |
| A0A183MUB4 | 21-284 | None |
| T1ESS3 | 30-268 | None |
| A0A6L5CMT3 | 229-460 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.