DPCstruct | MC32116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 100 ± 10 aa |
| Standard deviation of domain lengths | 10.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 49.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1HZN0 | 1-92 | FWDWVGGRYSLWSAIGLSIILSVGFDNFVELLSGAHAMDKHFSTTPAEKNLPVLLALIGIWYNNFFGAETEAILPYDQYMHRFAAYF… |
| A0A653CLA8 | 1-107 | MFGFWDWVGGRYSLWSAIGLSISLSIGFDNFVQLLEGAHWMDKHFTSAPLEKNGPVILALLGIWYNNFFGAETQALLPYDQYLHRFA… |
| D7G558 | 30-123 | None |
| A0A482SSP6 | 74-164 | None |
| G0EU32 | 129-227 | None |
| A0A1V3XM54 | 98-200 | None |
| A0A6F8T2Q5 | 75-171 | None |
| A0A6G3V9Y5 | 26-121 | None |
| S7NBG6 | 3-87 | None |
| A0A7J6YRM5 | 15-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.