DPCstruct | MC32115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 104 ± 15 aa |
| Standard deviation of domain lengths | 15.18 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 30.82 |
| Pfam Score | 97.56 |
| Assigned Pfam label(s) | CL0012- CL0255- PF08625 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9JYE9 | 10-106 | ERFSYQQRLKAAVHYTVGCLCEEVTSDKEMQFSKQTIAAISEVTFRQCENFAKDLEMFARHAKRSTINTEDVKLLARRSNSLLKYIT… |
| A0A653CKC1 | 4-99 | VQKTKHSIYNTARKLAKEVAADLKVEFHQDVLDIIAELVYKKLVLYGGDMDAFQKHAKRSTITADDVKLLVRRSESLKAVVEAKMKL… |
| A0A3M7D447 | 50-151 | None |
| A0A0G4L9Q3 | 3-98 | None |
| B9FEY6 | 1-100 | None |
| A0A7J7IE01 | 5-115 | None |
| C1MX59 | 2-117 | None |
| A0A6A4JWE5 | 1-91 | None |
| A0A485NEF6 | 9-117 | None |
| A0A835RI54 | 32-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.