DPCstruct | MC32113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 151 ± 25 aa |
| Standard deviation of domain lengths | 25.07 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 70.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.79 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.25 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | CL0357- PF13821- CL0449 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653CHD5 | 8-148 | EAPRVVIRYNRAERHKNELKSLKKLCGIKSYNPDSKLADGYTDRAQRRRDTVGSQNPHEKTQVASVDESISKENKGFKLLQKMGWKE… |
| A0A2I2Z5Z1 | 39-174 | INVQEDIRPGLPMLRQIREARRKEEKQQEANLKNRQKSLKEEEQERRDIGLKNALGCENKGFALLQKMGYKSGQALGKSGGGIVEPI… |
| I1CLP0 | 12-134 | None |
| A0A287D6N3 | 710-855 | None |
| A0A1X2I8V0 | 227-357 | None |
| A0A0D2MGG8 | 1-161 | None |
| A0A7S0VJK8 | 1-191 | None |
| F0WS22 | 470-632 | None |
| A0A0B7N7K6 | 146-277 | None |
| A0A0B1S6E8 | 2-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.