DPCstruct | MC32112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 158 ± 31 aa |
| Standard deviation of domain lengths | 31.34 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A556U0Z9 | 261-437 | MLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQAIRKLVKDGLIIKKPVTVHSRARCRKNTLARRKGRHMGVGKRKGTANARM… |
| A0A653CFB8 | 4-148 | GKKKVWLDPDEVNEIAKTNSRQNIRMLIKDGLIIKKPVAVHSHARVRKNTEAGRTGRHCEFGKRRGTANARMPQEELCMRVLRRLLK… |
| A0A5J5UIX3 | 12-106 | None |
| R1GJL8 | 228-402 | None |
| A0A813W4Q0 | 136-343 | None |
| A0A154PF53 | 3-151 | None |
| A0A834T1Y9 | 72-233 | None |
| A0A2R6CVU0 | 8-115 | None |
| A0A0D3CJH7 | 24-224 | None |
| A0A438N198 | 34-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.