DPCstruct | MC32111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 146 ± 13 aa |
| Standard deviation of domain lengths | 13.35 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368FD88 | 65-189 | YLVKCMENKRMDKCNQFFLKCAAQTQNNPAWTEWFAFPYHPKPEACQAFRKYYSHEWREIFVISLHNFVRVAVQSSPRSHLVQMVEL… |
| A0A6A4VGX5 | 91-233 | MRRYVVQAASSTETAGNRNRDKVHEFFEKMAPEIHNRPEWRDWFALPFLKAPEDHPTFSVFFSRQWQDTLAVSLHNFLAIVFQCMPR… |
| A0A814DZ14 | 140-297 | None |
| A0A5A7PNK0 | 776-938 | None |
| A0A6A4VMP7 | 1-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.