DPCstruct | MC3211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 88 ± 10 aa |
| Standard deviation of domain lengths | 9.79 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U6JRH3 | 54-135 | LTLAPLERLAVPHTLSGADGENRSTAFCYIQANHDLDAVRAYLNRYRDQPKTLRAYTKELERFLLWAVVLRGKALSDLRVDD |
| A0A6J5H5N3 | 1-90 | MGTALITPRPLDKLALPDDLDGRNGTNRAIGRRQIGAYDDLDAFSAWLARVASTKNAFDNYRKDTELLLVCLIVQLSKPLSSLTHED… |
| A0A158L531 | 34-120 | None |
| A0A2C9BJF1 | 10-99 | None |
| A0A2L0X2N5 | 259-371 | None |
| A0A6J5FD83 | 145-222 | None |
| A0A7W8V381 | 10-96 | None |
| A0A125JT96 | 1-101 | None |
| A0A0B6RWB2 | 77-166 | None |
| E5AUF0 | 29-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.