DPCstruct | MC32107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 107 ± 10 aa |
| Standard deviation of domain lengths | 10.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 64.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06524 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672I6C8 | 1-115 | MPKKKTGARKKAESRKEREKQIRANREHVDVAKHPCNVNMECDKCQRKQKNRAFCYFCSSVQKLPVCAQCGKTKCMKSSDCVIKHPG… |
| A0A1Y1KP59 | 1-99 | MPKKKTGQRKKAEKQKLRQKEIRTSRDNIGLAQHPCNAVMECEKCNRKQKNRAFCYFCQNLQRLPMCAQCGKTKCMAKAGDCVIRHP… |
| C4WV84 | 1-118 | None |
| A0A5B7CMI2 | 1-96 | None |
| A0A1A9X665 | 92-207 | None |
| A0A1S0U0Z7 | 1-119 | None |
| A0A4Z2JGV6 | 1-96 | None |
| A0A835L2L5 | 93-211 | None |
| A0A6G0ZDA9 | 171-269 | None |
| T2M2A9 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.