DPCstruct | MC32106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 145 ± 25 aa |
| Standard deviation of domain lengths | 24.67 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 71.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1KN05 | 2-187 | VNSTKQVNKVKPNVNRTTTDSLVSPGFNSRPPEQDTTSYAGYHLAYEVKKLMPTSRSSGGTNQNNNGVALPVGLADDQAKDFDFEKT… |
| A0A1I7V4S3 | 1-98 | MKYDSTGMFHWCPSRNLEDCVLERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELKHVVIVGDLEYLRKEWKTL… |
| A0A6I9Q0U5 | 54-244 | None |
| S4RL33 | 135-300 | None |
| A0A6Q8PFS3 | 587-754 | None |
| A0A183VPC3 | 170-304 | None |
| A0A0B1PQV8 | 300-429 | None |
| E9IJ12 | 418-583 | None |
| A0A368F069 | 1-121 | None |
| A0A3Q0DZ23 | 1-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.