DPCstruct | MC32105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 492 ± 106 aa |
| Standard deviation of domain lengths | 105.53 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 75.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.32 |
| Pfam Score | 72.32 |
| Assigned Pfam label(s) | CL0063- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1KGI0 | 5-585 | HQNSGRQLIVAEYNDNAVAVLCLNEVLNEPLLNEEFELAPFYGLRKSHLDDNVYDLIRPSSITGLLSDGAERELTSLVNILQLEEAE… |
| A0A7S3QR29 | 1-325 | MNAQPSVFAITMACLDELYEPQAWNFLQEAFDAFPDKQYCVLTLPHDSPEPPLVSSFTRLDPLPGNSFPEVLYLINRHALIEGFEVR… |
| A0A7R9I447 | 1-576 | None |
| A0A482T007 | 337-752 | None |
| F6QD44 | 244-748 | None |
| E2BP73 | 8-579 | None |
| A0A6P4EFU8 | 40-638 | None |
| A0A183T885 | 1-565 | None |
| A0A5J4NCG8 | 3-399 | None |
| A0A139AT32 | 179-487 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.