DPCstruct | MC32101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 394 ± 45 aa |
| Standard deviation of domain lengths | 45.05 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 33.65 |
| Pfam Score | 80.00 |
| Assigned Pfam label(s) | PF00566- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1JZ68 | 1-384 | MTDNGKLVSFPIIQLIYAAPEVYLDGPNGNLSNPKVDVWSAGIVLAELVLNKPLWQSLKVGQRIRKVLSLVQGNTSIFERIAREHNC… |
| A0A6J1QY24 | 112-440 | LVHRHLSPDNILIKKNGDVQLYNYGLYYMTDGGKNVSFPIGSPKYTAPEVFLTPSPSGVKIDSWSLGMIIAEQLLGQPVWPGVKLSQ… |
| A0A1Y2B632 | 132-520 | None |
| A0A811L333 | 520-926 | None |
| T1GJ66 | 2-338 | None |
| A0A0K0E5T4 | 131-552 | None |
| A0A7J7F6V7 | 26-456 | None |
| A0A818GB28 | 546-978 | None |
| A0A1S3DQW0 | 1-323 | None |
| A0A0J7KZC5 | 141-463 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.