DPCstruct | MC32100
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 126 ± 30 aa |
| Standard deviation of domain lengths | 29.59 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 86.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 38.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02755 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R8Q8M2 | 3-119 | LHAVLQLKLQQRRTREELVSQGIMPPLKSPAAFHEQRKSLERARTEDYLKRKIRSRPERSELVRMHILEETSAEPSLQAKQLKLKRA… |
| A0A2S7QD36 | 8-104 | TDRPTTKELKDRHILLDTDAAPLKKGLEKRPTKEDLVERNILPSTSAAPGIQAQQKELQKHMRADSLNEKISHRPKPEELVKQGVLH… |
| A0A0B7NFC7 | 2-80 | None |
| A0A5N5PYJ5 | 5-136 | None |
| A0A2W1BF28 | 30-149 | None |
| A0A066V4T9 | 26-181 | None |
| A0A553MX23 | 36-172 | None |
| A0A817FH08 | 37-158 | None |
| S3BYW1 | 174-268 | None |
| S4R9R4 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.