DPCstruct | MC321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 166 ± 22 aa |
| Standard deviation of domain lengths | 22.15 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S9P5T1 | 1-133 | MQIVHEHEQRETIVIDRFYPDHPPRTESALFRRTKHHLVHVLDTPCYVCGTKEGREVHHFHAEWADANGIDWKKMRRLHPAFDWSSY… |
| A0A1I6LZQ5 | 14-206 | RNKEGAVLAQGDITRLHDQLTNYKIVKQHIQHHTIDELQFYPDHDPRRESPEYTKTHHHLCVELDLPCLVCGVKYSTLGDKKANRYS… |
| A0A329ME00 | 1-134 | None |
| A0A559KD11 | 1-183 | None |
| A0A202B2Y7 | 24-227 | None |
| A0A2P8CCK2 | 4-170 | None |
| A0A402CNC9 | 1-150 | None |
| A0A540W6V4 | 6-142 | None |
| A0A525JFG9 | 82-255 | None |
| B7DP76 | 4-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.