DPCstruct | MC32096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 174 ± 27 aa |
| Standard deviation of domain lengths | 27.05 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 25.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T4CJH6 | 56-216 | DKKEEERTRVSFGAGPGALVKGWPAKGGIYLLDDCFGIDLDFLKLDRFQETLQPSQSGPDAAAEEEAHCNRMRQLGAVWWESLQEWA… |
| A0A2S7P3D0 | 4-167 | DEDSSCPYPMPLPHTIRTEFGSRGCTVYGYCSTGGVLVKEANILDMNFLSLDRLHSAERSDDAAEEDKFCGSMLKVGATWWKSRQEW… |
| G9NEJ9 | 1-126 | None |
| A0A6V8HNV8 | 14-204 | None |
| A0A194WB91 | 44-225 | None |
| E4USC1 | 10-213 | None |
| A0A6A6AHB5 | 82-257 | None |
| A0A1J9RW28 | 28-277 | None |
| A0A1L9VT06 | 4-135 | None |
| A0A2S4L2S9 | 25-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.