DPCstruct | MC32095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 211 ± 16 aa |
| Standard deviation of domain lengths | 16.26 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G4AYC6 | 1-189 | MNTTSTAKELEAQWINPGDVSTILFILGGDIVQKAFSQGTGKAYVPVCFSFGCAAYAFIGLVGIIGDGRLLSPPDYACKVLNLGSGY… |
| A0A2S7NUN5 | 1-223 | MLAIFDGPGDISEQFLAQWKNPGDVFSVLLIVGGDVILLALACLTGRTLTPIAFSFGWVAYAVSAVVGAVGDNKLLVRCPPEISLKV… |
| A0A1B7XTK4 | 1-187 | None |
| A0A094HWL8 | 2-222 | None |
| A0A395GRJ4 | 7-209 | None |
| A0A423WW06 | 519-726 | None |
| A0A094FCL7 | 6-210 | None |
| M7TK92 | 402-628 | None |
| A0A0G0APF2 | 196-397 | None |
| A0A2J6RWE0 | 64-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.